Choose one of the five choices you want to search:

Gene, Transcriptome, Protein, Pathway or Disease. 

Protein basic information

LiverAtlas Protein ID

HuLPr16974

Uniprot ID

D2Y6W4_HUMAN

Uniprot Acc

D2Y6W4;

Protein name

Cytochrome c oxidase subunit 1

Comment

FUNCTION:Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B (By similarity).||CATALYTIC ACTIVITY:4 ferrocytochrome c + O(2) + 4 H(+) = 4 ferricytochrome c + 2 H(2)O.||PATHWAY:Energy metabolism; oxidative phosphorylation.||SUBCELLULAR LOCATION:Mitochondrion inner membrane; Multi-pass membrane protein (By similarity).||SIMILARITY:Belongs to the heme-copper respiratory oxidase family.

Subcellular localization

Mitochondrion inner membrane;Multi-pass membrane protein(By similarity).

Gene name

cytochrome c oxidase subunit I

Protein sequence

SMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGV

Database cross reference

RefSeq Protein accession:YP_003024028
RefSeq Protein gi:251831109

Liver relevance

HLPP validation

Yes/No

Yes

Project name

Chinese Liver;Human Liver Organelles;

Ontology annotation

GO-C

GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005743;C:mitochondrial inner membrane;IEA:UniProtKB-SubCell. GO:0070469;C:respiratory chain;IEA:UniProtKB-KW.

GO-F

GO:0004129;F:cytochrome-c oxidase activity;IEA:EC. GO:0009055;F:electron carrier activity;IEA:InterPro. GO:0020037;F:heme binding;IEA:InterPro.

GO-P

GO:0009060;P:aerobic respiration;IEA:InterPro. GO:0022900;P:electron transport chain;IEA:UniProtKB-KW.