Protein basic information
LiverAtlas Protein ID |
HuLPr17828 |
Uniprot ID |
|
Uniprot Acc |
D6RHU0; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MKMLLLLHCLGVFLSCSGHIQDEHPQYHSPPDVVIPVRIT GTTRGMTPPGWLSYILPFGGQKHIIHIKVKKLLFSKHLP VFTYTDQGAIL |
Database cross reference |
RefSeq Protein accession:NP_001124175
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-F |
GO:0004222;F:metalloendopeptidase activity;IEA:InterPro. GO:0008270;F:zinc ion binding;IEA:InterPro. |
GO-P |
GO:0006508;P:proteolysis;IEA:InterPro. |