Protein basic information
LiverAtlas Protein ID |
HuLPr18152 |
Uniprot ID |
|
Uniprot Acc |
Q96PH6;Q17RC4;Q8N691;Q9NUH0; |
Protein name |
Beta-defensin 118 |
Comment |
FUNCTION:Has antibacterial activity (Potential).||SUBCELLULAR LOCATION:Secreted.||TISSUE SPECIFICITY:High-level and epididymis-specific expression. Most abundant in the epithelium of the caput and is also present in the lumen and bound to sperm. Expressed also in pancreas.||SIMILARITY:Belongs to the beta-defensin family. |
Subcellular localization |
Secreted. |
Gene name |
|
Protein sequence
|
MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKD GEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPG IIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPN VHHSS |
Database cross reference |
RefSeq Protein accession:NP_473453
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Fetal Liver;Human Liver Organelles;Chinese Liver;French Liver; |
Ontology annotation
GO-C |
GO:0005576;C:extracellular region;IEA:UniProtKB-SubCell. |
GO-P |
GO:0007160;P:cell-matrix adhesion;NAS:UniProtKB. GO:0042742;P:defense response to bacterium;TAS:UniProtKB. GO:0045087;P:innate immune response;TAS:UniProtKB. GO:0007283;P:spermatogenesis;NAS:UniProtKB. |