Protein basic information
LiverAtlas Protein ID |
HuLPr18335 |
Uniprot ID |
|
Uniprot Acc |
Q9GZP9;Q9Y3A7; |
Protein name |
Derlin-2 |
Comment |
FUNCTION:Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal glycoproteins, but not that of misfolded nonglycoproteins. May act by forming a channel that allows the retrotranslocation of misfolded glycoproteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the degradation substrate. In contrast to DERL1, it is not involved in the degradation of MHC class I heavy chains following infection by cytomegaloviruses. May play a role in cell proliferation.||SUBUNIT:Forms homo- and heterooligomers with DERL3 and, to a lesser extent, with DERL1. Interacts with SELS, VCP and EDEM1. Mediates association between VCP and EDEM1, as well as that between VCP and the degradation substrate. Interacts with the SEL1L/SYVN1 and VCP/SELS protein complexes. Interacts with OS9.||SUBCELLULAR LOCATION:Endoplasmic reticulum membrane; Multi-pass membrane protein.||TISSUE SPECIFICITY:Ubiquitous. |
Subcellular localization |
Endoplasmic reticulum membrane;Multi-pass membrane protein. |
Gene name |
|
Protein sequence
|
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQ LYFNPELIFKHFQIWRLITNFLFFGPVGFNFLFNMIFLY RYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLV FLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWV LMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGI RILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG |
Database cross reference |
RefSeq Protein accession:NP_057125
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0030176;C:integral to endoplasmic reticulum membrane;IDA:UniProtKB. |
GO-F |
GO:0005515;F:protein binding;IPI:UniProtKB. |
GO-P |
GO:0030968;P:endoplasmic reticulum unfolded protein response;IDA:UniProtKB. GO:0030433;P:ER-associated protein catabolic process;IMP:UniProtKB. GO:0030307;P:positive regulation of cell growth;IDA:UniProtKB. GO:0008284;P:positive regulation of cell proli |
Post-translational modification
LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
HuLPr18335 |
PHOSPHORYLATION |
218 |
Y |
PhosphoSitePlus |
LTP |
N |
![]() ![]() ![]() ![]() ![]() |