Protein basic information
| LiverAtlas Protein ID |
HuLPr18656 |
|
Uniprot ID |
|
|
Uniprot Acc |
P01903;A2BET4;Q30160;Q6IAZ1;Q861I2;Q9TP70; |
|
Protein name |
HLA class II histocompatibility antigen, DR alpha chain |
|
Comment |
FUNCTION:Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accomodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC clas |
|
Subcellular localization |
Cell membrane;Single-pass type I membrane protein.Endoplasmic reticulum membrane;Single-pass type I membrane protein.Golgi apparatus, trans-Golgi network membrane;Single-pass type I membrane protein.Endosome membrane;Single- pass type I membrane protein.Lysosome membrane;Single-pass type I membrane protein.Late endosome membrane;Single-pass type I membrane protein. |
|
Gene name |
|
|
Protein sequence
|
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLN PDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASF EAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLT NSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGV SETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLD EPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGT IFIIKGVRKSNAAERRGPL |
|
Database cross reference |
RefSeq Protein accession:NP_061984
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver; |
Ontology annotation
| GO-C |
GO:0005789;C:endoplasmic reticulum membrane;IEA:UniProtKB-SubCell. GO:0005794;C:Golgi apparatus;IEA:UniProtKB-SubCell. GO:0005887;C:integral to plasma membrane;NAS:UniProtKB. GO:0031902;C:late endosome membrane;IDA:UniProtKB. GO:0005765;C:lysosomal mem |
|
GO-F |
GO:0032395;F:MHC class II receptor activity;NAS:UniProtKB. |
|
GO-P |
GO:0002504;P:antigen processing and presentation of peptide or polysaccharide antigen via MHC class II;IEA:UniProtKB-KW. GO:0060333;P:interferon-gamma-mediated signaling pathway;TAS:Reactome. GO:0031295;P:T cell costimulation;TAS:Reactome. GO:0050852;P: |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr18656 |
UBIQUITINATION |
244 |
K |
PhosphoSitePlus |
LTP |
N |
 
|
Pathway
| Pathway name | |
| Pathway name | |
| Pathway name | |
| Pathway name |
