Protein basic information
LiverAtlas Protein ID |
HuLPr18723 |
Uniprot ID |
|
Uniprot Acc |
Q9NRW4;B4DK56;Q59GW2;Q5VWR2;Q96AR1; |
Protein name |
Dual specificity protein phosphatase 22 |
Comment |
FUNCTION:Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N- terminal kinase (SAPK/JNK) (By similarity).||CATALYTIC ACTIVITY:Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.||CATALYTIC ACTIVITY:A phosphoprotein + H(2)O = a protein + phosphate.||SUBUNIT:Monomer.||SUBCELLULAR LOCATION:Cytoplasm (By similarity). Nucleus (By similarity).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NRW4-1; Sequence=Displayed; Name=2; IsoId=Q9NRW4-2; Sequence=VSP 019614;||TISSUE SPECIFICITY:Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.||SIMILARITY:Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.||SIMILARITY:Contains 1 tyrosine-protein phosphatase domain.||SEQUENCE CAUTION:Sequence=AAH16844.1; Type=Erroneous initiation; |
Subcellular localization |
Cytoplasm(By similarity).Nucleus(By similarity). |
Gene name |
|
Protein sequence
|
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDS ARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRL RGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTV RAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGES PLQDAEEAKNILAAPGILKFWAFLRRL |
Database cross reference |
RefSeq Protein accession:NP_064570
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;IEA:UniProtKB-SubCell. GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0004725;F:protein tyrosine phosphatase activity;IEA:EC. GO:0008138;F:protein tyrosine/serine/threonine phosphatase activity;IBA:RefGenome. |
GO-P |
GO:0006915;P:apoptosis;TAS:ProtInc. GO:0008283;P:cell proliferation;TAS:ProtInc. GO:0000188;P:inactivation of MAPK activity;TAS:ProtInc. GO:0007275;P:multicellular organismal development;TAS:ProtInc. GO:0046330;P:positive regulation of JNK cascade;IBA: |
Pathway
Pathway name |