Protein basic information
LiverAtlas Protein ID |
HuLPr19380 |
Uniprot ID |
|
Uniprot Acc |
E5RJR0; |
Protein name |
Uncharacterized protein |
Comment |
DOMAIN:A pair of annexin repeats may form one binding site for calcium and phospholipid (By similarity).||SIMILARITY:Belongs to the annexin family.||SIMILARITY:Contains 1 annexin repeat.||CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDK EAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELT GKFERLIVGLMRPPAYCDAKEIKDAISGIGT |
Database cross reference |
RefSeq Protein accession:NP_001146
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0005509;F:calcium ion binding;IEA:InterPro. GO:0005544;F:calcium-dependent phospholipid binding;IEA:UniProtKB-KW. |