Protein basic information
LiverAtlas Protein ID |
HuLPr19492 |
Uniprot ID |
|
Uniprot Acc |
E7EMP8; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 |
Protein sequence
|
MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLD DKQWLTTISQYDKEVGQWNKFRDEVEDDYFRTWSPGKPF DQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHR |
Database cross reference |
RefSeq Protein accession:NP_001035249
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |