Protein basic information
LiverAtlas Protein ID |
HuLPr19606 |
Uniprot ID |
|
Uniprot Acc |
E7EPU7; |
Protein name |
Uncharacterized protein |
Comment |
SIMILARITY:Belongs to the ATPase C chain family.||CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) |
Protein sequence
|
MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQV ARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGT VFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLM VAFLILFAM |
Database cross reference |
RefSeq Protein accession:NP_001002027
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0045263;C:proton-transporting ATP synthase complex, coupling factor F(o);IEA:InterPro. |
GO-F |
GO:0046933;F:hydrogen ion transporting ATP synthase activity, rotational mechanism;IEA:HAMAP. |
GO-P |
GO:0015991;P:ATP hydrolysis coupled proton transport;IEA:InterPro. GO:0015986;P:ATP synthesis coupled proton transport;IEA:InterPro. |