Protein basic information
LiverAtlas Protein ID |
HuLPr19932 |
Uniprot ID |
|
Uniprot Acc |
E7EWH7; |
Protein name |
Uncharacterized protein |
Comment |
SIMILARITY:Belongs to the small heat shock protein (HSP20) family.||CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MSSACPRLAKLLASLLRCPAKAKRTGNGRPPPHPTTGLLS EPRVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGK HNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGM LTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS |
Database cross reference |
RefSeq Protein accession:NP_000385
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0005212;F:structural constituent of eye lens;IEA:InterPro. |
GO-P |
GO:0009408;P:response to heat;IEA:InterPro. |