Protein basic information
LiverAtlas Protein ID |
HuLPr20148 |
Uniprot ID |
|
Uniprot Acc |
E9PAR2; |
Protein name |
Uncharacterized protein |
Comment |
SIMILARITY:Belongs to the bZIP family.||CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKR ELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTL IEELKALKDLYCHKVE |
Database cross reference |
RefSeq Protein accession:NP_001872
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:InterPro. |
GO-F |
GO:0046983;F:protein dimerization activity;IEA:InterPro. GO:0043565;F:sequence-specific DNA binding;IEA:InterPro. GO:0003700;F:sequence-specific DNA binding transcription factor activity;IEA:InterPro. |
GO-P |
GO:0006355;P:regulation of transcription, DNA-dependent;IEA:InterPro. |