Protein basic information
LiverAtlas Protein ID |
HuLPr21079 |
Uniprot ID |
|
Uniprot Acc |
E9PNU8; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa |
Protein sequence
|
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCS GLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKLEA YANLYVDTL |
Database cross reference |
RefSeq Protein accession:NP_001190983
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005743;C:mitochondrial inner membrane;IEA:InterPro. |
GO-F |
GO:0008137;F:NADH dehydrogenase (ubiquinone) activity;IEA:InterPro. |
GO-P |
GO:0006120;P:mitochondrial electron transport, NADH to ubiquinone;IEA:InterPro. |