Protein basic information
LiverAtlas Protein ID |
HuLPr21662 |
Uniprot ID |
|
Uniprot Acc |
Q6VEP3;A6NC04;B2RP05;Q6VEP0;Q6VEP1;Q6VEP4;Q6VEP5;Q8NG00; |
Protein name |
Protein FAM138A/B/C/F |
Comment |
TISSUE SPECIFICITY:Expressed in retina.||MISCELLANEOUS:Found within a region of subtelomeric DNA that is duplicated in a polymorphic distribution to multiple chromosomes. Contains interchromosomal sequence variation; the polymorphic changes causes amino-acid substitution.||SIMILARITY:Belongs to the FAM138 family. |
Gene name |
|
Protein sequence
|
MLLTIETKSHYVAQAGLELLASSDPPTSASQSVGIIDMSH CTWPTLGKFLNPSKPHFSPITKGKDGNIFPTKFLSDALT ELRLCT |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |