Protein basic information
LiverAtlas Protein ID |
HuLPr22157 |
Uniprot ID |
|
Uniprot Acc |
F2Z298; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIEN |
Database cross reference |
RefSeq Protein accession:NP_000240
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:InterPro. |
GO-F |
GO:0005524;F:ATP binding;IEA:InterPro. GO:0030983;F:mismatched DNA binding;IEA:InterPro. |
GO-P |
GO:0006298;P:mismatch repair;IEA:InterPro. |