Protein basic information
LiverAtlas Protein ID |
HuLPr22188 |
Uniprot ID |
|
Uniprot Acc |
F2Z3D0; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPL SKLMKAYCERQLEMEDEDTIDVFQQQTGGVY |
Database cross reference |
RefSeq Protein accession:NP_001005849
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver; |