Protein basic information
LiverAtlas Protein ID |
HuLPr23261 |
Uniprot ID |
|
Uniprot Acc |
A8MUU1; |
Protein name |
Putative fatty acid-binding protein 5-like protein 3 |
Comment |
FUNCTION:High specificity for fatty acids (By similarity).||DOMAIN:Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior (By similarity).||SIMILARITY:Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.||CAUTION:Could be the product of a pseudogene. |
Gene name |
|
Protein sequence
|
MGAMAKPDCIITCDSKNLTIKTESTLKTTQFSGTLGEKFE ENTADGRRTQTVCNFTDGALVQHQEWDGKESTITRKLKD GKLVVERVMNHVACTRIYEKAQ |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0008289;F:lipid binding;IEA:UniProtKB-KW. GO:0005215;F:transporter activity;IEA:InterPro. |
Post-translational modification
LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
HuLPr23261 |
ACETYLATION |
21 |
K |
PhosphoSitePlus |
HTP |
N |
![]() ![]() ![]() ![]() ![]() |