Protein basic information
LiverAtlas Protein ID |
HuLPr23337 |
Uniprot ID |
|
Uniprot Acc |
O75015; |
Protein name |
Low affinity immunoglobulin gamma Fc region receptor III-B |
Comment |
FUNCTION:Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.||SUBUNIT:Monomer. Interacts with INPP5D/SHIP1 (By similarity).||SUBCELLULAR LOCATION:Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Note=Secreted after cleavage.||TISSUE SPECIFICITY:Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils.||PTM:Glycosylated. Glycosylation plays an inhibitory role in the interaction with IgG3.||PTM:The soluble form is produced by a proteolytic cleavage.||POLYMORPHISM:There are three allelic forms of FCGR3B:FCGR3B*01 (NA-1), FCGR3B*02 (HNA-1b, NA-2) (shown here) and SH. FCGR3B*01 and FCGR3B*02 are detectable with antibodies against the biallelic neutrophil-s |
Subcellular localization |
Cell membrane;Lipid-anchor, GPI-anchor.Secreted. |
Gene name |
|
Protein sequence
|
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEK DSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAA TVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVF KEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDF HIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAV STISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI |
Database cross reference |
RefSeq Protein accession:NP_000561
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0031225;C:anchored to membrane;IEA:UniProtKB-KW. GO:0005576;C:extracellular region;IEA:UniProtKB-SubCell. GO:0005886;C:plasma membrane;IEA:UniProtKB-SubCell. |
GO-F |
GO:0019864;F:IgG binding;IEA:UniProtKB-KW. GO:0004872;F:receptor activity;IEA:UniProtKB-KW. |
GO-P |
GO:0006955;P:immune response;TAS:ProtInc. |