Protein basic information
LiverAtlas Protein ID |
HuLPr23514 |
Uniprot ID |
|
Uniprot Acc |
Q8NAU1;A6NMC9;D3DPQ6;Q6P6D9;Q7Z676; |
Protein name |
Fibronectin type III domain-containing protein 5 |
Comment |
SUBCELLULAR LOCATION:Peroxisome membrane; Single-pass type I membrane protein (By similarity). Note=Imported in peroxisomes through the PEX5 receptor pathway (By similarity).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q8NAU1-1; Sequence=Displayed; Name=2; IsoId=Q8NAU1-2; Sequence=VSP 032861, VSP 032862; Note=No experimental confirmation available; Name=3; IsoId=Q8NAU1-3; Sequence=VSP 032860, VSP 032863; Note=No experimental confirmation available; Name=4; IsoId=Q8NAU1-4; Sequence=VSP 032860; Note=No experimental confirmation available;||SIMILARITY:Contains 1 fibronectin type-III domain. |
Subcellular localization |
Peroxisome membrane;Single-pass type I membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
MRRWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDV LEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDL EEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASK NKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFC RQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI |
Database cross reference |
RefSeq Protein accession:NP_001165411
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005778;C:peroxisomal membrane;IEA:UniProtKB-SubCell. |