Protein basic information
LiverAtlas Protein ID |
HuLPr23950 |
Uniprot ID |
|
Uniprot Acc |
O75223;B2RDN0;Q9BS37; |
Protein name |
Gamma-glutamylcyclotransferase |
Comment |
FUNCTION:Catalyzes the formation of 5-oxoproline from gamma- glutamyl dipeptides and may play a significant role in glutathione homeostasis. Induces release of cytochrome c from mitochondria with resultant induction of apoptosis.||CATALYTIC ACTIVITY:(Gamma-L-glutamyl)-L-amino acid = 5-oxoproline + L-amino acid.||BIOPHYSICOCHEMICAL PROPERTIES:Kinetic parameters: KM=2.0 mM for gamma-glutamyl-L-alanine; Vmax=50.3 umol/min/mg enzyme;||SUBUNIT:Homodimer (Probable).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O75223-1; Sequence=Displayed; Name=2; IsoId=O75223-2; Sequence=VSP 035599, VSP 035600; Note=No experimental confirmation available;||INDUCTION:By geranylgeraniol.||SIMILARITY:Belongs to the gamma-glutamylcyclotransferase family. |
Gene name |
|
Protein sequence
|
MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAF FCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEV WGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGK EITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQ EKLKAIEPNDYTGKVSEEIEDIIKKGETQTL |
Database cross reference |
RefSeq Protein accession:NP_001186744
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Chinese Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005829;C:cytosol;IDA:UniProtKB. |
GO-F |
GO:0008415;F:acyltransferase activity;IEA:UniProtKB-KW. GO:0003839;F:gamma-glutamylcyclotransferase activity;IDA:UniProtKB. GO:0042803;F:protein homodimerization activity;IDA:UniProtKB. |
GO-P |
GO:0001836;P:release of cytochrome c from mitochondria;IMP:UniProtKB. |
Pathway
Pathway name |