Protein basic information
| LiverAtlas Protein ID |
HuLPr23977 |
|
Uniprot ID |
|
|
Uniprot Acc |
P13284;Q76MF9;Q8NEI4;Q8WU77;Q9UL08; |
|
Protein name |
Gamma-interferon-inducible lysosomal thiol reductase |
|
Comment |
FUNCTION:Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II- restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds (By similarity). Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T cells or crosspresentation (By similarity).||BIOPHYSICOCHEMICAL PROPERTIES:Kinetic parameters: KM=1200 uM for F(ab')2 fragment when denatured; KM=10 uM for F(ab')2 fragment; Note=Kinetic parameters shown are for mature enzyme; pH dependence: Optimum pH is 4-5;||SUBUNIT:Dimer; disulfide-linked.||SUBCELLULAR LOCATION:Secreted. Lysosome.||INDUCTION:Expressed constitutively in antigen-presenting cells and induced by IFN-gamma in other cell types.||PTM:N-glycosylated. Sugar chains contain mannose-6-phosphate |
|
Subcellular localization |
Secreted.Lysosome. |
|
Gene name |
|
|
Protein sequence
|
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPP VNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFL IRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQ HGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMER SLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTD ALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPD VCPSSTSSLRSVCFK |
|
Database cross reference |
RefSeq Protein accession:NP_006323
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver; |
Ontology annotation
| GO-C |
GO:0030054;C:cell junction;IDA:HPA. GO:0005576;C:extracellular region;TAS:ProtInc. GO:0005764;C:lysosome;IDA:UniProtKB. |
|
GO-F |
GO:0016667;F:oxidoreductase activity, acting on a sulfur group of donors;IMP:UniProtKB. |
|
GO-P |
GO:0042590;P:antigen processing and presentation of exogenous peptide antigen via MHC class I;ISS:UniProtKB. GO:0060333;P:interferon-gamma-mediated signaling pathway;TAS:Reactome. GO:0055114;P:oxidation-reduction process;IEA:UniProtKB-KW. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr23977 |
PHOSPHORYLATION |
45 |
T |
PhosphoSitePlus |
LTP |
N |
|
Pathway
| Pathway name |
