Protein basic information
LiverAtlas Protein ID |
HuLPr24503 |
Uniprot ID |
|
Uniprot Acc |
Q6DRA6; |
Protein name |
Putative histone H2B type 2-D |
Comment |
FUNCTION:Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.||SUBUNIT:The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.||SUBCELLULAR LOCATION:Nucleus. Chromosome.||PTM:Phosphorylated on Ser-15 by STK4/MST1 during apoptosis; which facilitates apoptotic chromatin condensation. Also phosphorylated on Ser-15 in response to DNA double strand breaks (DSBs), and in correlation with somatic hypermutation and immunoglobulin class- switch recombination.||MISCELLANE |
Subcellular localization |
Nucleus.Chromosome. |
Gene name |
|
Protein sequence
|
MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSI YVYKVLKRVHPDTGIWCKAMGIMNSFLNDIFERIAGEAS RLAHYNKRSTITSRRSRRPCACCCPASWPSTPCPRAPRR SPSTPAPSESLPGPGARSLPPSLPPRVAGCFVSKGSFQG HLTPLVK |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0000786;C:nucleosome;IEA:UniProtKB-KW. GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0003677;F:DNA binding;IEA:UniProtKB-KW. |
GO-P |
GO:0006334;P:nucleosome assembly;IEA:InterPro. |