Choose one of the five choices you want to search:

Gene, Transcriptome, Protein, Pathway or Disease. 

Protein basic information

LiverAtlas Protein ID

HuLPr24581

Uniprot ID

HCST_HUMAN

Uniprot Acc

Q9UBK5;Q9UBS1;Q9Y3Y0;

Protein name

Hematopoietic cell signal transducer

Comment

FUNCTION:Transmembrane adapter protein which associates with NKG2D to form an activation receptor NKG2D-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and UL16-binding proteins (ULBPs); these ligands are up-regulated by stress conditions and pathological state such as viral infection and tumor transformation. Functions as docking site for PI3-kinase PIK3R1 and GRB2. Interaction of ULBPs with NKG2D-DAP10 triggers calcium mobilization and activation of the PIK3R1, MAP2K/ERK, and JAK2/STAT5 signaling pathways. Both PIK3R1 and GRB2 are required for full NKG2D-HCST-mediated activation and ultimate killing of target cells. In NK cells, NKG2D-HCST signaling directly induces cytotoxicity and enhances cytokine production initiated via DAP12/TYROBP-associated receptors. In T cells, it provides primarily costimulation for TCR-induced signals. NKG2D

Subcellular localization

Membrane;Single-pass type I membrane protein.

Gene name

hematopoietic cell signal transducer

Protein sequence

MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCS GCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPA QEDGKVYINMPGRG

Database cross reference

RefSeq Protein accession:NP_001007470
RefSeq Protein gi:56117854

Liver relevance

HLPP validation

Yes/No

Yes

Project name

Chinese Liver;French Liver;Human Liver Organelles;

Ontology annotation

GO-C

GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005886;C:plasma membrane;TAS:Reactome.

GO-P

GO:0050776;P:regulation of immune response;TAS:Reactome.