Protein basic information
LiverAtlas Protein ID |
HuLPr24593 |
Uniprot ID |
|
Uniprot Acc |
Q8IV16;Q6P3T2;Q86W15; |
Protein name |
Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 |
Comment |
FUNCTION:Plays a key role in the lipolytic processing of chylomicrons (By similarity).||SUBUNIT:Binds with high affinity to high-density lipoprotein (HDL) (By similarity). Binds to lipoprotein lipase (LPL), chylomicrons and APOA5.||SUBCELLULAR LOCATION:Cell membrane; Single-pass membrane protein (Potential). Note=Localized at the cell surface.||POLYMORPHISM:The missense variant Arg-56 may be associated with severe hypertriglyceridemia and chylomicronemia.||SIMILARITY:Contains 1 UPAR/Ly6 domain.||CAUTION:The mouse ortholog has been suggested to be a GPI- anchored protein, but no GPI-anchor is detected by prediction methods. |
Subcellular localization |
Cell membrane;Single-pass membrane protein(Potential). |
Gene name |
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 |
Protein sequence
|
MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDE EDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNL TQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPIT KTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGP RGSSETVGAALLLNLLAGLGAMGARRP |
Database cross reference |
RefSeq Protein accession:NP_835466
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver; |
Ontology annotation
GO-C |
GO:0031362;C:anchored to external side of plasma membrane;IDA:BHF-UCL. GO:0034364;C:high-density lipoprotein particle;IEA:UniProtKB-KW. GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |
GO-F |
GO:0034185;F:apolipoprotein binding;IPI:BHF-UCL. GO:0035478;F:chylomicron binding;IDA:BHF-UCL. GO:0035473;F:lipase binding;IPI:BHF-UCL. GO:0008289;F:lipid binding;IEA:UniProtKB-KW. |
GO-P |
GO:0042632;P:cholesterol homeostasis;ISS:BHF-UCL. GO:0090321;P:positive regulation of chylomicron remnant clearance;ISS:BHF-UCL. GO:0051006;P:positive regulation of lipoprotein lipase activity;IMP:BHF-UCL. GO:0050821;P:protein stabilization;ISS:BHF-UCL. |