Protein basic information
LiverAtlas Protein ID |
HuLPr24642 |
Uniprot ID |
|
Uniprot Acc |
Q6WQI6; |
Protein name |
Putative cancer susceptibility gene HEPN1 protein |
Comment |
SUBCELLULAR LOCATION:Cytoplasm.||TISSUE SPECIFICITY:Expressed in liver. Expression is either downregulated or lost in hepatocellular carcinomas (HCC).||CAUTION:Product of a dubious CDS prediction. Encoded by the 3'- UTR of HEPACAM. |
Subcellular localization |
Cytoplasm. |
Gene name |
|
Protein sequence
|
MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQ RASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLATQR PSLFILMLV |
Database cross reference |
RefSeq Protein accession:NP_001032647
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;IEA:UniProtKB-SubCell. |