Protein basic information
| LiverAtlas Protein ID |
HuLPr24657 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q96HZ4;A8KAP6;Q53SN9;Q8N2J2;Q96T93;Q9P2S3; |
|
Protein name |
Transcription cofactor HES-6 |
|
Comment |
FUNCTION:Does not bind DNA itself but suppresses both HES1- mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowing ASCL1 and TCF3 to up-regulate transcription in its presence. Promotes cell differentation (By similarity).||SUBUNIT:Transcription repression requires formation of a complex with a corepressor protein of the Groucho/TLE family. Interacts with HES1 (By similarity).||SUBCELLULAR LOCATION:Nucleus (Probable).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q96HZ4-1; Sequence=Displayed; Name=2; IsoId=Q96HZ4-2; Sequence=VSP 011152; Note=No experimental confirmation available; Name=3; IsoId=Q96HZ4-3; Sequence=VSP 040128;||DOMAIN:The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to spec |
|
Subcellular localization |
Nucleus(Probable). |
|
Gene name |
|
|
Protein sequence
|
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRAR INESLQELRLLLAGAEVQAKLENAEVLELTVRRVQGVLR GRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAID ATVAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPG RSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQA PAEGPDLVPAALGSLTTAQIARSVWRPW |
|
Database cross reference |
RefSeq Protein accession:NP_001136325
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Human Liver Organelles;Chinese Liver; |
Ontology annotation
| GO-C |
GO:0005667;C:transcription factor complex;ISS:UniProtKB. |
|
GO-F |
GO:0003677;F:DNA binding;IEA:InterPro. GO:0003700;F:sequence-specific DNA binding transcription factor activity;TAS:ProtInc. GO:0003712;F:transcription cofactor activity;ISS:UniProtKB. GO:0030528;F:transcription regulator activity;IEA:InterPro. |
|
GO-P |
GO:0030154;P:cell differentiation;IEA:UniProtKB-KW. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr24657 |
PHOSPHORYLATION |
183 |
S |
PhosphoSitePlus |
LTP |
N |
 
|
Pathway
| Pathway name |
