Protein basic information
| LiverAtlas Protein ID |
HuLPr24806 |
|
Uniprot ID |
|
|
Uniprot Acc |
O60760;Q6FHT9; |
|
Protein name |
Hematopoietic prostaglandin D synthase |
|
Comment |
FUNCTION:Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide.||CATALYTIC ACTIVITY:(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy- 11-oxoprosta-5,13-dienoate.||CATALYTIC ACTIVITY:RX + glutathione = HX + R-S-glutathione.||COFACTOR:Glutathione. Required for the prostaglandin D synthase activity.||ENZYME REGULATION:Prostaglandin PGD2 synthesis is stimulated by calcium and magnesium ions. One calcium or magnesium ion is bound between the subunits of the homodimer. The interactions with the protein are for the most part mediated via water molecules. Magnesium increases the affinity for glutathione, while calcium has no effect o |
|
Subcellular localization |
Cytoplasm. |
|
Gene name |
|
|
Protein sequence
|
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWP EIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAG NTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNE LLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICS TTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
|
Database cross reference |
RefSeq Protein accession:NP_055300
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0005737;C:cytoplasm;IDA:HPA. GO:0005634;C:nucleus;IDA:HPA. |
|
GO-F |
GO:0005509;F:calcium ion binding;IDA:UniProtKB. GO:0004364;F:glutathione transferase activity;IEA:EC. GO:0000287;F:magnesium ion binding;IDA:UniProtKB. GO:0004667;F:prostaglandin-D synthase activity;IDA:UniProtKB. GO:0042803;F:protein homodimerization |
|
GO-P |
GO:0007626;P:locomotory behavior;TAS:ProtInc. GO:0001516;P:prostaglandin biosynthetic process;IEA:UniProtKB-KW. GO:0007165;P:signal transduction;NAS:ProtInc. |
Pathway
| Pathway name | |
| Pathway name |
