Protein basic information
LiverAtlas Protein ID |
HuLPr24996 |
Uniprot ID |
|
Uniprot Acc |
Q969J5;Q08AH7;Q6UWM1;Q96A41;Q96QR0; |
Protein name |
Interleukin-22 receptor subunit alpha-2 |
Comment |
FUNCTION:Isoform 2 is a receptor for IL22. Binds to IL22, prevents interaction with the functional IL-22R complex and blocks the activity of IL22 (in vitro). May play an important role as an IL22 antagonist in the regulation of inflammatory responses.||FUNCTION:Isoform 1 may play a role in establishing and maintaining successful pregnancy.||SUBCELLULAR LOCATION:Secreted.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Long, CRF2-10L, CRF2-s1-long; IsoId=Q969J5-1; Sequence=Displayed; Name=2; Synonyms=Short, CRF2-10, CRF2-s1-short; IsoId=Q969J5-2; Sequence=VSP 013105; Name=3; Synonyms=CRF2-10S; IsoId=Q969J5-3; Sequence=VSP 013105, VSP 013106, VSP 013107;||TISSUE SPECIFICITY:Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expressed only in placenta. Isoform 2 is expr |
Subcellular localization |
Secreted. |
Gene name |
|
Protein sequence
|
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRN FHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKP SGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSC DLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWE TKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIE DYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHS SYCVVAEIYQPMLDRRSQRSEERCVEIP |
Database cross reference |
RefSeq Protein accession:NP_443194
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;NAS:UniProtKB. |
GO-F |
GO:0042018;F:interleukin-22 receptor activity;IDA:UniProtKB. |
GO-P |
GO:0042516;P:regulation of tyrosine phosphorylation of Stat3 protein;ISS:UniProtKB. |
Pathway
Pathway name |