Protein basic information
LiverAtlas Protein ID |
HuLPr25031 |
Uniprot ID |
|
Uniprot Acc |
Q9Y6W8;Q8N6W8; |
Protein name |
Inducible T-cell costimulator |
Comment |
FUNCTION:Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up- regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up- regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre- activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes (By similarity).||SUBUNIT:Homodimer; disulfide-linked.||SUBCELLULAR LOCATION:Isoform 1:Cell membrane; Single-pass type I membrane protein (Potential).||SUBCELLULAR LOCATION:Isoform 2:Secreted (Potential).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y6W8-1; Sequence=Displayed; Name=2; IsoId=Q9Y6W8-2; Sequence=VSP 010788; Note=No experimental confirmation ava |
Subcellular localization |
Isoform 1:Cell membrane;Single-pass type I membrane protein(Potential). |
Gene name |
|
Protein sequence
|
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQI LCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKS LKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPP FKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILG CILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL |
Database cross reference |
RefSeq Protein accession:NP_036224
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005576;C:extracellular region;IEA:UniProtKB-SubCell. |
GO-P |
GO:0006955;P:immune response;NAS:UniProtKB. GO:0031295;P:T cell costimulation;TAS:Reactome. |
Pathway
Pathway name |