Protein basic information
LiverAtlas Protein ID |
HuLPr25201 |
Uniprot ID |
|
Uniprot Acc |
Q8WWZ1;Q53SR9;Q56AT8;Q7RTZ5;Q969H5;Q9BYX1; |
Protein name |
Interleukin-1 family member 10 |
Comment |
FUNCTION:Binds soluble IL-1 receptor type 1.||SUBCELLULAR LOCATION:Secreted.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8WWZ1-1; Sequence=Displayed; Name=2; IsoId=Q8WWZ1-2; Sequence=VSP 002658; Note=No experimental confirmation available;||TISSUE SPECIFICITY:Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.||SIMILARITY:Belongs to the IL-1 family.||WEB RESOURCE:Name=Wikipedia; Note=Interleukin-1 entry; URL="http://en.wikipedia.org/wiki/Interleukin 1";||WEB RESOURCE:Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/il1f10/"; |
Subcellular localization |
Secreted. |
Gene name |
|
Protein sequence
|
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAE KICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSL QLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWP GWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW |
Database cross reference |
RefSeq Protein accession:NP_115945
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;IEA:UniProtKB-KW. |
GO-F |
GO:0005125;F:cytokine activity;IEA:UniProtKB-KW. GO:0005152;F:interleukin-1 receptor antagonist activity;IEA:InterPro. |