Protein basic information
LiverAtlas Protein ID |
HuLPr25207 |
Uniprot ID |
|
Uniprot Acc |
Q9HBE4;A5J0L4; |
Protein name |
Interleukin-21 |
Comment |
FUNCTION:Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.||SUBCELLULAR LOCATION:Secreted.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9HBE4-1; Sequence=Displayed; Name=2; Synonyms=IL-21iso; IsoId=Q9HBE4-2; Sequence=VSP 030129;||TISSUE SPECIFICITY:Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.||SIMILARITY:Belongs to the IL-15/IL-21 family.||SEQUENCE CAUTION:Sequence=AAG29348.1; Type=Erroneous i |
Subcellular localization |
Secreted. |
Gene name |
|
Protein sequence
|
MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVD QLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKS ANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSC DSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Database cross reference |
RefSeq Protein accession:NP_068575
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;NAS:UniProtKB. |
GO-F |
GO:0005125;F:cytokine activity;IEA:UniProtKB-KW. GO:0005134;F:interleukin-2 receptor binding;IPI:UniProtKB. |
GO-P |
GO:0048469;P:cell maturation;IDA:UniProtKB. GO:0006955;P:immune response;IEA:InterPro. GO:0050729;P:positive regulation of inflammatory response;IC:BHF-UCL. GO:0045078;P:positive regulation of interferon-gamma biosynthetic process;NAS:UniProtKB. GO:003 |
Pathway
Pathway name |