Protein basic information
LiverAtlas Protein ID |
HuLPr25214 |
Uniprot ID |
|
Uniprot Acc |
Q8NEV9;A0N0L2;Q6P676; |
Protein name |
Interleukin-27 subunit alpha |
Comment |
FUNCTION:Cytokine with pro- and anti-inflammatory properties, that can regulate T helper cell development, suppress T-cell proliferation, stimulate cytotoxic T cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon- gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR which appears to be required but not sufficient for IL-27-mediated signal transduction. IL-27 potentiate the early phase of TH1 response and suppress TH2 and TH17 differentiation. It induces the differentiation of TH1 cells via two distinct pathways, p38 MAPK/TBX21- and ICAM1/ITGAL/ERK- dependent pathways. It also induces STAT1, STAT3, ST |
Subcellular localization |
Secreted. |
Gene name |
|
Related liver disease name |
|
Protein sequence
|
MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSL QELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLY LLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHA LLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLA AGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVS WPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLG FPTLSPQP |
Database cross reference |
RefSeq Protein accession:NP_663634
|
Liver relevance
HCC significant Proteins |
Yes/No |
Yes |
Quality score |
|
|
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;ISS:UniProtKB. |
GO-F |
GO:0005125;F:cytokine activity;IEA:UniProtKB-KW. GO:0045523;F:interleukin-27 receptor binding;ISS:UniProtKB. |
GO-P |
GO:0006954;P:inflammatory response;IEA:UniProtKB-KW. GO:0045087;P:innate immune response;IEA:UniProtKB-KW. GO:0045078;P:positive regulation of interferon-gamma biosynthetic process;IDA:UniProtKB. GO:0050688;P:regulation of defense response to virus;IEA: |
Pathway
Pathway name | |
Pathway name |