Protein basic information
LiverAtlas Protein ID |
HuLPr25409 |
Uniprot ID |
|
Uniprot Acc |
P48544;B2R744;Q6DK13;Q6DK14;Q92807; |
Protein name |
G protein-activated inward rectifier potassium channel 4 |
Comment |
FUNCTION:This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.||SUBUNIT:May associate with GIRK1 and GIRK2 to form a G-protein- activated heteromultimer pore-forming unit. The resulting inward current is much larger (By similarity).||SUBCELLULAR LOCATION:Membrane; Multi-pass membrane protein.||TISSUE SPECIFICITY:Islets, exocrine pancreas and heart.||DISEASE:Defects in KCNJ5 are the cause of long QT syndrome type 13 (LQT13) [MIM:613485]. It is a heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ven |
Subcellular localization |
Membrane;Multi-pass membrane protein. |
Gene name |
potassium inwardly-rectifying channel, subfamily J, member 5 |
Protein sequence
|
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRT RLLAEGKKPRQRYMEKSGKCNVHHGNVQETYRYLSDLFT TLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDL DHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVI TEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKR AETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIR AKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPL IISHEINQKSPFWEMSQAQLHQEEFEVVVILEGMVEATG MTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFH DTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAE AGLDAEAEQNEEDEPKGLGGSREARGSV |
Database cross reference |
RefSeq Protein accession:NP_000881
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0008076;C:voltage-gated potassium channel complex;TAS:ProtInc. |
GO-F |
GO:0015467;F:G-protein activated inward rectifier potassium channel activity;TAS:UniProtKB. GO:0005515;F:protein binding;IPI:BHF-UCL. |
GO-P |
GO:0007268;P:synaptic transmission;TAS:Reactome. |