Protein basic information
LiverAtlas Protein ID |
HuLPr25425 |
Uniprot ID |
|
Uniprot Acc |
P05161;Q5SVA4;Q7Z2G2;Q96GF0; |
Protein name |
Ubiquitin-like protein ISG15 |
Comment |
FUNCTION:Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral act |
Subcellular localization |
Cytoplasm.Secreted. |
Gene name |
|
Protein sequence
|
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHA FQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCD EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQ DDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG GTEPGGRS |
Database cross reference |
RefSeq Protein accession:NP_005092
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005829;C:cytosol;EXP:Reactome. GO:0005615;C:extracellular space;NAS:UniProtKB. |
GO-F |
GO:0005515;F:protein binding;IPI:IntAct. |
GO-P |
GO:0007267;P:cell-cell signaling;NAS:UniProtKB. GO:0044419;P:interspecies interaction between organisms;IEA:UniProtKB-KW. GO:0032020;P:ISG15-protein conjugation;IDA:HGNC. GO:0032480;P:negative regulation of type I interferon production;TAS:Reactome. GO |
Pathway
Pathway name |