Protein basic information
LiverAtlas Protein ID |
HuLPr25941 |
Uniprot ID |
|
Uniprot Acc |
Q9NRX6; |
Protein name |
Protein kish-B |
Comment |
FUNCTION:Involved in the early part of the secretory pathway.||SUBCELLULAR LOCATION:Golgi apparatus membrane; Single-pass type I membrane protein.||SIMILARITY:Belongs to the KISH family. |
Subcellular localization |
Golgi apparatus membrane;Single-pass type I membrane protein. |
Gene name |
|
Protein sequence
|
MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKG VWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK |
Database cross reference |
RefSeq Protein accession:NP_064526
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0000139;C:Golgi membrane;IEA:UniProtKB-SubCell. GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |