Protein basic information
LiverAtlas Protein ID |
HuLPr26649 |
Uniprot ID |
|
Uniprot Acc |
Q9UHA4;B2R4A1;Q9H364; |
Protein name |
Ragulator complex protein LAMTOR3 |
Comment |
FUNCTION:Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, recruits the Rag GTPases and the mTORC1 complex to lysosomes, a key step in activation of the TOR signaling cascade by amino acids. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.||SUBUNIT:Interacts with MAP2K1 and MAPK2. Interacts with MORG1 (By similarity). Part of the Ragulator complex composed of LAMTOR1, LAMTOR2 and LAMTOR3. Interacts with LAMTOR1; the interaction is direct.||INTERACTION:Q9JHS3:Robld3 (xeno); NbExp=1; IntAct=EBI-1038192, EBI-1038198;||SUBCELLULAR LOCATION:Late endosome membrane; Peripheral membrane protein; Cytoplasmic side (By similarity).||SIMILARITY:Belongs to the LAMTOR3 family. |
Subcellular localization |
Late endosome membrane;Peripheral membrane protein;Cytoplasmic side(By similarity). |
Gene name |
|
Protein sequence
|
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNA PEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQ VVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELR QVVEVS |
Database cross reference |
RefSeq Protein accession:NP_068805
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0071986;C:Ragulator complex;IDA:UniProtKB. |
GO-F |
GO:0005515;F:protein binding;IPI:IntAct. |
GO-P |
GO:0034613;P:cellular protein localization;IMP:UniProtKB. GO:0071230;P:cellular response to amino acid stimulus;IMP:UniProtKB. GO:0032008;P:positive regulation of TOR signaling cascade;IMP:UniProtKB. |
Pathway
Pathway name |