Protein basic information
| LiverAtlas Protein ID |
HuLPr26714 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q9Y5Y7;Q8TC18;Q9UNF4; |
|
Protein name |
Lymphatic vessel endothelial hyaluronic acid receptor 1 |
|
Comment |
FUNCTION:Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as an hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.||SUBUNIT:Homodimer; disulfide-linked. Interacts with PDGFB and IGFBP3. Forms a transient ternary complex with PDGFB and PDGFRB in TGN (By similarity).||SUBCELLULAR LOCATION:Membrane; Single-pass type I membrane protein. Note=Localized to the plasma membrane and in vesicles near extranuclear membranes which may represent trans-Golgi network (TGN) and endosomes/prelysosomeal compartments. Undergoes ligand-dependent internalization and recycling at the cell surface.||TISSUE SPECIFICITY:Mainly |
|
Subcellular localization |
Membrane;Single-pass type I membrane protein. |
|
Gene name |
|
|
Protein sequence
|
MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMG ITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALK ASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKV PVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTAT QTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRR KKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGG VPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQ KEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKT TVRCLEAEV |
|
Database cross reference |
RefSeq Protein accession:NP_006682
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0005887;C:integral to plasma membrane;TAS:ProtInc. GO:0005624;C:membrane fraction;TAS:ProtInc. |
|
GO-P |
GO:0009653;P:anatomical structure morphogenesis;TAS:ProtInc. GO:0007160;P:cell-matrix adhesion;TAS:ProtInc. GO:0006928;P:cellular component movement;TAS:ProtInc. GO:0009611;P:response to wounding;TAS:ProtInc. GO:0006810;P:transport;IEA:UniProtKB-KW. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr26714 |
PHOSPHORYLATION |
280 |
T |
PhosphoSitePlus |
HTP |
N |
 
|
