Protein basic information
LiverAtlas Protein ID |
HuLPr26828 |
Uniprot ID |
|
Uniprot Acc |
Q9H0U3;B2RAR4;D3DTE3;Q53G00;Q8NBN6; |
Protein name |
Magnesium transporter protein 1 |
Comment |
FUNCTION:May be involved in N-glycosylation through its association with N-oligosaccharyl transferase. May be involved in Mg(2+) transport in epithelial cells.||SUBUNIT:Weakly associates with the oligosaccharyl transferase (OST) complex which contains at least RPN1/ribophorin I, RPN2/ribophorin II, OST48, DAD1, and either STT3A or STT3B (By similarity).||SUBCELLULAR LOCATION:Endoplasmic reticulum membrane; Multi-pass membrane protein (Probable).||TISSUE SPECIFICITY:Expressed in placenta, liver, muscle and pancreas, and at very low levels in brain, lung and kidney.||DISEASE:Defects in MAGT1 are the cause of mental retardation X- linked type 95 (MRX95) [MIM:300716]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific X-linked mental retardation which also present with associated physical, neurological and/or |
Subcellular localization |
Endoplasmic reticulum membrane;Multi-pass membrane protein(Probable). |
Gene name |
|
Protein sequence
|
MAARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEK VSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFT ALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAM VDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQ VRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLL AVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQM WNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLL FNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLF FSWMLSIFRSKYHGYPYSFLMS |
Database cross reference |
RefSeq Protein accession:NP_115497
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0008250;C:oligosaccharyltransferase complex;IDA:HGNC. |
GO-P |
GO:0018279;P:protein N-linked glycosylation via asparagine;TAS:HGNC. |