Protein basic information
| LiverAtlas Protein ID |
HuLPr27430 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q8IXL7;B4DR19;B7ZAQ0;Q6UXS2; |
|
Protein name |
Methionine-R-sulfoxide reductase B3 |
|
Comment |
FUNCTION:Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.||CATALYTIC ACTIVITY:L-methionine + oxidized thioredoxin = L- methionine R-oxide + reduced thioredoxin.||COFACTOR:Binds 1 zinc ion per subunit.||SUBUNIT:Monomer.||SUBCELLULAR LOCATION:Isoform 1:Endoplasmic reticulum.||SUBCELLULAR LOCATION:Isoform 2:Mitochondrion.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=A; IsoId=Q8IXL7-1; Sequence=Displayed; Name=2; Synonyms=B, C, D; IsoId=Q8IXL7-2; Sequence=VSP 040883; Note=Has a transit peptide;||TISSUE SPECIFICITY:Widely expressed.||DISEASE:Defects in MSRB3 are the cause of deafness autosomal recessive type 74 (DFNB74) [MIM:613718]. A form of non-syndromic sensorineural deafness characterized by prelingual, bilateral, profound hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of t |
|
Subcellular localization |
Isoform 1:Endoplasmic reticulum. |
|
Gene name |
|
|
Protein sequence
|
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKN CKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHK DPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAI TFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRY CINSAALSFTPADSSGTAEGGSGVASPAQADKAEL |
|
Database cross reference |
RefSeq Protein accession:NP_001026849
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0005783;C:endoplasmic reticulum;IDA:HGNC. GO:0005739;C:mitochondrion;IDA:HGNC. |
|
GO-F |
GO:0008113;F:peptide-methionine-(S)-S-oxide reductase activity;IEA:InterPro. GO:0000318;F:protein-methionine-R-oxide reductase activity;IDA:HGNC. GO:0008270;F:zinc ion binding;IDA:HGNC. |
|
GO-P |
GO:0030091;P:protein repair;IDA:HGNC. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr27430 |
PHOSPHORYLATION |
52 |
Y |
PhosphoSitePlus |
LTP |
N |
 
|
Pathway
| Pathway name |
