Protein basic information
LiverAtlas Protein ID |
HuLPr27670 |
Uniprot ID |
|
Uniprot Acc |
Q9BZM6;Q8IZW3;Q8IZX6; |
Protein name |
NKG2D ligand 1 |
Comment |
FUNCTION:Ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis- Golgi apparatus so that it does not reach the cell surface.||SUBUNIT:Interacts with the CMV glycoprotein UL16. Does not bind to beta2-microglobulin.||SUBCELLULAR LOCATION:Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum. Note=Detected intracellularly in the endoplasmic reticulum of CMV-infected fibroblasts.||TISSUE SPECIFICITY:Expressed in T-cells, |
Subcellular localization |
Cell membrane;Lipid-anchor, GPI-anchor.Endoplasmic reticulum. |
Gene name |
|
Protein sequence
|
MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIIT PKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGK KVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEP LTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRK WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEE FLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLII FLCFILAGR |
Database cross reference |
RefSeq Protein accession:NP_079494
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0031225;C:anchored to membrane;IEA:UniProtKB-KW. GO:0005783;C:endoplasmic reticulum;IEA:UniProtKB-SubCell. GO:0042612;C:MHC class I protein complex;IEA:InterPro. |
GO-F |
GO:0032393;F:MHC class I receptor activity;NAS:UniProtKB. |
GO-P |
GO:0019882;P:antigen processing and presentation;IEA:InterPro. GO:0006955;P:immune response;IEA:InterPro. GO:0030101;P:natural killer cell activation;NAS:UniProtKB. GO:0050776;P:regulation of immune response;TAS:Reactome. |