Protein basic information
LiverAtlas Protein ID |
HuLPr27672 |
Uniprot ID |
|
Uniprot Acc |
Q9BZM4;Q8IZX5;Q8TE75; |
Protein name |
NKG2D ligand 3 |
Comment |
FUNCTION:Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP2. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. Has lower affinity for NKG2D compared to ULBP1 and ULBP2 and induces weaker signaling responses than does ULBP2 or ULBP1.||SUBUNIT:Does not interact with the CMV glycoprotein UL16. Does not bind to beta2-microglobulin.||SUBCELLULAR LOCATION:Cell membrane; Lipid-anchor, GPI-anchor.||MISCELLANEOUS:The ULBPs are unusual members of the extended MHC class I superfamily, because they do not contain the alpha 3 domain and they lack a transmembrane domain. They are unlikely to present peptides.||MISCELLANEOUS:The region from chromosome 6q24.1-6q25.3 contains as many as 10 ULBP-related sequences, many of which are pseudogenes.||SIMILARITY:Belongs to |
Subcellular localization |
Cell membrane;Lipid-anchor, GPI-anchor. |
Gene name |
|
Protein sequence
|
MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTI IHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLE EQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSG PLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNR KWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLR DFLMHRKKRLEPTAPPTMAPGLAQPKAIATTLSPWSFLI ILCFILPGI |
Database cross reference |
RefSeq Protein accession:NP_078794
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0031225;C:anchored to membrane;IEA:UniProtKB-KW. GO:0042612;C:MHC class I protein complex;IEA:InterPro. |
GO-F |
GO:0032393;F:MHC class I receptor activity;NAS:UniProtKB. |
GO-P |
GO:0019882;P:antigen processing and presentation;IEA:InterPro. GO:0006955;P:immune response;IEA:InterPro. GO:0030101;P:natural killer cell activation;NAS:UniProtKB. |