Protein basic information
LiverAtlas Protein ID |
HuLPr27735 |
Uniprot ID |
|
Uniprot Acc |
Q8N7R0; |
Protein name |
Putative homeobox protein NANOG2 |
Comment |
FUNCTION:Probable transcriptional regulator.||SUBCELLULAR LOCATION:Nucleus (By similarity).||DEVELOPMENTAL STAGE:Expressed in embryonic stem cells (ES).||SIMILARITY:Belongs to the Nanog homeobox family.||SIMILARITY:Contains 1 homeobox DNA-binding domain.||CAUTION:Could be the product of a pseudogene. According to PubMed:15233988.||CAUTION:Exists an other tandem duplicated gene (NANOG) and 10 other NANOG-related nucleotide sequences located on different chromosomes, all of which are processed pseudogenes lacking introns (NANOGP2 to NANOGP11); except NANOGP8 which is a retrogene. |
Subcellular localization |
Nucleus(By similarity). |
Gene name |
|
Protein sequence
|
MDLPIQDSHDSSTSPKGKQPTTAEKSATKKEDKVPVKKQK TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSY KQVKTWFQNQRMKSKRWQKNNWLKNSNGVTQGCLVNPTG NLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQS WNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLQAALEA AGEGLNVIQQTTRYFNTPQTMDLFLNYSMNMQPEDV |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0043565;F:sequence-specific DNA binding;IEA:InterPro. GO:0003700;F:sequence-specific DNA binding transcription factor activity;IEA:InterPro. |