Protein basic information
LiverAtlas Protein ID |
HuLPr27996 |
Uniprot ID |
|
Uniprot Acc |
Q96E22;B2RWQ4;O00251; |
Protein name |
Nogo-B receptor |
Comment |
FUNCTION:Acts as a specific receptor for the N-terminus of Nogo- B, a neural and cardiovascular regulator. Able to regulate vascular remodeling and angiogenesis. Its similarity with UPP synthase proteins suggests that it may act as a scaffold for the binding of isoprenyl lipids and/or prenylated proteins.||SUBCELLULAR LOCATION:Membrane; Single-pass type I membrane protein (Potential). Note=Colocalizes with Nogo-B during VEGF and wound healing angiogenesis.||MISCELLANEOUS:Although strongly related to UPP synthase family proteins, it has no lipid transferase activity.||SIMILARITY:Belongs to the UPP synthase family.||SEQUENCE CAUTION:Sequence=AAB72234.1; Type=Frameshift; Positions=Several; |
Subcellular localization |
Membrane;Single-pass type I membrane protein(Potential). |
Gene name |
nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) |
Protein sequence
|
MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRC CRAASAAVLAPLGFTLRKPPAVGRNRRHHRHPRGGSCLA AAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIA SLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQ ELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDG KADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGC PDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISY EDFFSALRQYAACEQRLGK |
Database cross reference |
RefSeq Protein accession:NP_612468
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |
GO-F |
GO:0004872;F:receptor activity;IEA:UniProtKB-KW. GO:0016765;F:transferase activity, transferring alkyl or aryl (other than methyl) groups;IEA:InterPro. |
GO-P |
GO:0001525;P:angiogenesis;IEA:UniProtKB-KW. GO:0030154;P:cell differentiation;IEA:UniProtKB-KW. |