Protein basic information
LiverAtlas Protein ID |
HuLPr28252 |
Uniprot ID |
|
Uniprot Acc |
Q7Z6K4;B8A4K5; |
Protein name |
Notch-regulated ankyrin repeat-containing protein |
Comment |
FUNCTION:May play a role in the formation of somites (By similarity).||SIMILARITY:Belongs to the NRARP family.||SIMILARITY:Contains 2 ANK repeats. |
Gene name |
|
Protein sequence
|
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNC EFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRL ANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR |
Database cross reference |
RefSeq Protein accession:NP_001004354
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-P |
GO:0045746;P:negative regulation of Notch signaling pathway;IMP:MGI. GO:0090263;P:positive regulation of canonical Wnt receptor signaling pathway;IMP:MGI. |
Pathway
Pathway name |