Protein basic information
| LiverAtlas Protein ID |
HuLPr28324 |
|
Uniprot ID |
|
|
Uniprot Acc |
P34130;Q6FH56; |
|
Protein name |
Neurotrophin-4 |
|
Comment |
FUNCTION:Target-derived survival factor for peripheral sensory sympathetic neurons.||SUBCELLULAR LOCATION:Secreted.||TISSUE SPECIFICITY:Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.||DISEASE:Defects in NTF4 may be associated with susceptibility to primary open angle glaucoma type 1O (GLC1O) [MIM:613100]. A form of primary open angle glaucoma (POAG). POAG is characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. The disease is asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place.||SIMILARITY:Belongs to the NGF-beta family. |
|
Subcellular localization |
Secreted. |
|
Gene name |
|
|
Protein sequence
|
MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWD LLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPANRSR RGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREV EVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGG CRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRID TACVCTLLSRTGRA |
|
Database cross reference |
RefSeq Protein accession:NP_006170
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0005788;C:endoplasmic reticulum lumen;ISS:UniProtKB. GO:0005576;C:extracellular region;ISS:UniProtKB. |
|
GO-F |
GO:0008083;F:growth factor activity;TAS:ProtInc. |
|
GO-P |
GO:0008344;P:adult locomotory behavior;ISS:UniProtKB. GO:0008544;P:epidermis development;ISS:UniProtKB. GO:0007402;P:ganglion mother cell fate determination;ISS:UniProtKB. GO:0007616;P:long-term memory;ISS:UniProtKB. GO:0008052;P:sensory organ boundary |
Pathway
| Pathway name | |
| Pathway name | |
| Pathway name |
