Protein basic information
LiverAtlas Protein ID |
HuLPr28366 |
Uniprot ID |
|
Uniprot Acc |
Q96DE0;Q96N82; |
Protein name |
U8 snoRNA-decapping enzyme |
Comment |
FUNCTION:RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8 snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (in vitro).||COFACTOR:Magnesium, manganese or cobalt. Binds 3 or 4 divalent metal cations. Acts specifically on U8 snoRNA with magnesium as cofactor. Has broad substrate specificity with bound manganese or cobalt (in vitro).||SUBUNIT:Homodimer.||SUBCELLULAR LOCATION:Nucleus, nucleolus (By similarity). Nucleus, nucleoplasm (By similarity). Note=Predominantly localized in nucleolus, and in a minor proportion in distinct foci in the nucleoplasm (By similarity).||SIMILARITY:Belongs to the Nudix hydrolase family.||SIMILARITY:Contains 1 nudix hydrolase domain.||SEQUENCE CAUTION:Sequence=BAB71024.1; Type=Erroneous initiation; Note=Translation N-terminally |
Subcellular localization |
Nucleus, nucleolus(By similarity).Nucleus, nucleoplasm(By similarity). |
Gene name |
nudix (nucleoside diphosphate linked moiety X)-type motif 16 |
Protein sequence
|
MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIP LRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELRE ELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLE ELLAVEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPT FLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH |
Database cross reference |
RefSeq Protein accession:NP_001165377
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005730;C:nucleolus;IEA:UniProtKB-SubCell. GO:0005654;C:nucleoplasm;IEA:UniProtKB-SubCell. |
GO-F |
GO:0016787;F:hydrolase activity;IEA:UniProtKB-KW. GO:0046872;F:metal ion binding;IEA:UniProtKB-KW. GO:0003723;F:RNA binding;IEA:UniProtKB-KW. |