Protein basic information
LiverAtlas Protein ID |
HuLPr28545 |
Uniprot ID |
|
Uniprot Acc |
O19637; |
Protein name |
MHC class I antigen HLA-B |
Comment |
SIMILARITY:Belongs to the MHC class I family. |
Gene name |
|
Protein sequence
|
SHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLS SWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRR HLENGKETLQRA |
Database cross reference |
RefSeq Protein accession:NP_005505
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver; |
Ontology annotation
GO-C |
GO:0042612;C:MHC class I protein complex;IEA:InterPro. |
GO-P |
GO:0019882;P:antigen processing and presentation;IEA:InterPro. GO:0006955;P:immune response;IEA:InterPro. |