Protein basic information
LiverAtlas Protein ID |
HuLPr29059 |
Uniprot ID |
|
Uniprot Acc |
P02818;Q5TCK6; |
Protein name |
Osteocalcin |
Comment |
FUNCTION:Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.||SUBCELLULAR LOCATION:Secreted.||PTM:Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.||SIMILARITY:Belongs to the osteocalcin/matrix Gla protein family.||SIMILARITY:Contains 1 Gla (gamma-carboxy-glutamate) domain.||WEB RESOURCE:Name=Wikipedia; Note=Osteocalcin entry; URL="http://en.wikipedia.org/wiki/Osteocalcin";||WEB RESOURCE:Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/bglap/"; |
Subcellular localization |
Secreted. |
Gene name |
|
Protein sequence
|
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQ EGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPD CDELADHIGFQEAYRRFYGPV |
Database cross reference |
RefSeq Protein accession:NP_954642
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0005509;F:calcium ion binding;IEA:InterPro. GO:0046848;F:hydroxyapatite binding;NAS:UniProtKB. GO:0008147;F:structural constituent of bone;NAS:UniProtKB. |
GO-P |
GO:0030282;P:bone mineralization;NAS:UniProtKB. GO:0007155;P:cell adhesion;NAS:UniProtKB. GO:0042476;P:odontogenesis;NAS:UniProtKB. GO:0030500;P:regulation of bone mineralization;IEA:InterPro. GO:0045124;P:regulation of bone resorption;NAS:UniProtKB. |
Pathway
Pathway name | |
Pathway name |
Validated_transcriptional_targets_of_AP1_family_members_Fra1_and_Fra2 |
Pathway name | |
Pathway name | |
Pathway name | |
Pathway name |