Protein basic information
LiverAtlas Protein ID |
HuLPr29598 |
Uniprot ID |
|
Uniprot Acc |
Q96FX8;E1P590;Q8IWS3;Q8N1J6;Q8NC16;Q9H1C5;Q9H230; |
Protein name |
p53 apoptosis effector related to PMP-22 |
Comment |
FUNCTION:Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).||SUBCELLULAR LOCATION:Cell junction, desmosome. Cell membrane; Multi-pass membrane protein (By similarity). Note=Associated with desmosomes (By similarity).||TISSUE SPECIFICITY:Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.||SIMILARITY:Belongs to the TMEM47 family. |
Subcellular localization |
Cell junction, desmosome.Cell membrane;Multi-pass membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSD HGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAA MLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALA AVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGW AATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA |
Database cross reference |
RefSeq Protein accession:NP_071404
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0030057;C:desmosome;IEA:UniProtKB-SubCell. GO:0005794;C:Golgi apparatus;IDA:HPA. GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005634;C:nucleus;IDA:HPA. |
GO-P |
GO:0006915;P:apoptosis;IEA:UniProtKB-KW. GO:0007155;P:cell adhesion;IEA:UniProtKB-KW. |
Pathway
Pathway name | |
Pathway name | |
Pathway name | |
Pathway name |