Protein basic information
LiverAtlas Protein ID |
HuLPr29627 |
Uniprot ID |
|
Uniprot Acc |
Q9BZM1;Q9BZ89; |
Protein name |
Group XIIA secretory phospholipase A2 |
Comment |
FUNCTION:PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl- phosphatidylcholine or -phosphatidylethanolamine.||CATALYTIC ACTIVITY:Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate.||COFACTOR:Binds 1 calcium ion per subunit (By similarity).||SUBCELLULAR LOCATION:Secreted. Cytoplasm.||TISSUE SPECIFICITY:Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.||MASS SPECTROMETRY:Mass=18702.6; Mass error=0.5; Method=MALDI; Range=22-189; Source=PubMed:11031251;||SIMILARITY:Belongs to the phospholipase A2 family. |
Subcellular localization |
Secreted.Cytoplasm. |
Gene name |
|
Protein sequence
|
MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRN GVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGY KPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCG KSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVE LLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL |
Database cross reference |
RefSeq Protein accession:NP_110448
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005576;C:extracellular region;NAS:UniProtKB. |
GO-F |
GO:0005509;F:calcium ion binding;IEA:InterPro. GO:0047498;F:calcium-dependent phospholipase A2 activity;NAS:UniProtKB. |
GO-P |
GO:0016042;P:lipid catabolic process;IEA:UniProtKB-KW. GO:0006644;P:phospholipid metabolic process;IEA:InterPro. |