Protein basic information
LiverAtlas Protein ID |
HuLPr30413 |
Uniprot ID |
|
Uniprot Acc |
Q9BT73;A4D216;A8MPW2; |
Protein name |
Proteasome assembly chaperone 3 |
Comment |
FUNCTION:Chaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.||SUBUNIT:Interacts with PSMG4. Interacts directly with alpha and beta subunits of the 20S proteasome but dissociates before the formation of half-proteasomes, probably upon recruitment of POMP.||SIMILARITY:Belongs to the PSMG3 family. |
Gene name |
|
Protein sequence
|
MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFG KMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFA KNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRV CQVW |
Database cross reference |
RefSeq Protein accession:NP_001127812
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |